gael584 gael584

18-10-2021
English

contestada

what is the tone of the story ""is grammar important""

Respuesta :

ayanna192 ayanna192

19-10-2021

Answer:

giving information so knowledge so the tone is

Explanation:

https.ffderaetcvhvgfdresawertyuijhgfdxswrt456ty7uhjbvcxdswqer

Answer Link

Otras preguntas

Write an algebraic expression to represent the verbal statement: The product of the difference of m and 7 and 6. PLS HELP

In what way you are strong? Mentally^

Help me quickly! please!!! A cable pulls a car up a mountain with a force of 4 × 103 N at a vertical constant velocity of 5 m.s-1. It takes 5 minutes to reach t

(2.6) Choose the correct answer below. O A. 24.6 O B. 24.64 OC. 22.62 OD. 2.64

a boat travels at 3.8m/s east across a river 240 m wide with a current of 1.6 m/s south. how long does it take to get across?

Helppppppp pleaseeeeeeeee!!!!

The concept of learning styles is well supported by the literature and is crucial for student achievement. The concept of learning styles is well supported by t

can someone help me?!!! I need help!! ASAP

(b) The pGoG protein is known to block the G, to S transition in the cell cycle. Explain why this prevents miosis from happenina in he cell (c) Before treating

Anyone know how to answer this